PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400040812
Common NameLOC102590407
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ZF-HD
Protein Properties Length: 244aa    MW: 27301.6 Da    PI: 7.3098
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400040812genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.65.5e-3251103356
           ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRre 56 
                           k +YkeClkNhA+ +GghavDGCgEf+p+ ge+g++++lkCaAC+CHRnFHR+ 
  PGSC0003DMP400040812  51 KPKYKECLKNHAVGVGGHAVDGCGEFLPA-GEDGSIDSLKCAACNCHRNFHRKI 103
                           679*************************9.999*******************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257743.0E-1553102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.4E-3053102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.9E-2853102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.38354103IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.608.4E-30167242IPR009057Homeodomain-like
SuperFamilySSF466898.71E-19169241IPR009057Homeodomain-like
PROSITE profilePS500718.908178242IPR001356Homeobox domain
TIGRFAMsTIGR015653.8E-24180236IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MEFEDQEKQR DEEIAAAPTH NDNSDSTTKM PPSPQLELEP LTAVQLWTNN KPKYKECLKN  60
HAVGVGGHAV DGCGEFLPAG EDGSIDSLKC AACNCHRNFH RKIAPPPLAT AAATGGEPVP  120
FVYHSHNQLP TYYRTLPPPC GYLQYHVAPH QRPLALPSTS GGYREDQEDI SNPNYSGGSK  180
KRFRTKFSQV QKEKMQELAD KLGWRIQRED EELVQQLCNE TGITRQVFKV WMHNNKHTLG  240
KKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A7e-221802381775ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755160.0HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006346746.10.0PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotA2Z2596e-69ZHD1_ORYSI; Zinc-finger homeodomain protein 1
TrEMBLM1C6690.0M1C669_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000606230.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.13e-58homeobox protein 22
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]